PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A01441.1.p
Common NameEUGRSUZ_A01441, LOC104437605
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 257aa    MW: 27728.1 Da    PI: 9.7761
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A01441.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-393090262
            zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                      k++al+cprC st+tkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+ s
  Eucgr.A01441.1.p 30 KDQALNCPRCTSTHTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRPS 90
                      7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-252682IPR003851Zinc finger, Dof-type
PfamPF027013.4E-333188IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7983488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDTAEWRQGI GVIKAMEGSS RPALRSRPQK DQALNCPRCT STHTKFCYYN NYSLSQPRYF  60
CKTCRRYWTE GGSLRNVPVG GGSRKNKRPS SSSPSTSSSS SKNKIIPNLT PPPPTILHSD  120
PQNPNNKPQE GQGFGLPSYL PAQAYAALSH HLPNPSSSSS PMEFLKSGGS WPSGLSLSSL  180
MAIPGSDSSA CMYSASAGFP LQELKPNLQY FSLAGLEAGE FKQVPSRTAE LEQMNRGQHG  240
DPSTGYWSKL MGGGSW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A01441.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048893.10.0PREDICTED: dof zinc finger protein DOF1.8-like
TrEMBLA0A059DEE30.0A0A059DEE3_EUCGR; Uncharacterized protein
STRINGVIT_16s0098g01420.t011e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-34Dof family protein